BI is not affiliated Build-a-Bearville or Build-a-Bear Workshop.
 
 




Closed Thread
  #1  
Old 06-29-2015, 06:39 AM
babv rock's Avatar
babv rock
Polar Bear
BABV Name: Kyleboysrule
 
Join Date: Apr 2009
Posts: 2,038
babv rock is just really nicebabv rock is just really nicebabv rock is just really nicebabv rock is just really nice
 babv rock is offline Status: Offline
Talking July Chat Thread

This may be super early, but yeah! :3

Lets make this thread active!

In other news, if you dont know, BI's domain will expire on August... This might be our Penultimate chat thread if the owners won't renew it.

Holidays in July!

July 1-Canada Day!
-CAMP HAPPY HEART!!!! (Who says you need BABV???)
-
This is the day we commemorate the loss of BI
July 4- Fourth of July, obviously
July 6- National Fried Chicken Day
July 7- Chocolate Day!
July 10- Teddy Bear Picnic Day!
July 13- Embrace your Geekness day!
July 19- National Ice Cream Day!
July 20- My first day of school... Ewww
- And oh, Curry day!!!
July 24- Cousins Day!!!
July 26- Parents Day!!!
July 29- National Lasagna Day!!!
July 30- International Day of Friendship
- National Cheesecake Day

Birthdays of Active People (Please tell me if I missed anything)
July 5-FayeTeddyBear (Sorry ^^)
July 6- Bambooski
July 12-StarrBalletBear
July 17-AliceDecember7


So lets make the most of these last two months (It depends)

Last edited by babv rock; 07-06-2015 at 02:01 AM..
  #2  
Old 06-29-2015, 10:30 AM
HoneyBanana30's Avatar
HoneyBanana30
Polar Bear
BABV Name: kAIKI IS BEST GIRL
 
Join Date: Jan 2010
Posts: 6,933
HoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud of
 HoneyBanana30 is offline Status: Offline
Default

Well, it's July on Wednesday! >w<
Yay!~

Don't forget Curry Day! \(^o^)/
  #3  
Old 06-29-2015, 10:35 AM
RachelGirl192's Avatar
RachelGirl192
Polar Bear
BABV Name: Rachelgirl192
 
Join Date: Jul 2011
Posts: 2,494
RachelGirl192 is a splendid one to beholdRachelGirl192 is a splendid one to beholdRachelGirl192 is a splendid one to beholdRachelGirl192 is a splendid one to beholdRachelGirl192 is a splendid one to beholdRachelGirl192 is a splendid one to beholdRachelGirl192 is a splendid one to beholdRachelGirl192 is a splendid one to behold
 RachelGirl192 is offline Status: Offline
Default

haha, did not know there were so many special days. Like the lasagna day and the teddy bear picnic one.
  #4  
Old 06-29-2015, 10:39 AM
HoneyBanana30's Avatar
HoneyBanana30
Polar Bear
BABV Name: kAIKI IS BEST GIRL
 
Join Date: Jan 2010
Posts: 6,933
HoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud ofHoneyBanana30 has much to be proud of
 HoneyBanana30 is offline Status: Offline
Default

Click the image to open in full size.

Made a bad thing. XD

View Post Originally Posted by RachelGirl192
haha, did not know there were so many special days. Like the lasagna day and the teddy bear picnic one.
Don't forget KFC Day. XD
They're really cool! And mad. XD
  #5  
Old 06-29-2015, 10:55 AM
VanessaMay18's Avatar
VanessaMay18
Trading Teddy
BABV Name: VanessaMay18 is alive again!
 
Join Date: Oct 2008
Posts: 14,115
VanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud of
 VanessaMay18 is offline Status: Offline
Default

I'll just start using this thread now. Why not. XD
Yay, it's almost Canada Day!
  #6  
Old 06-29-2015, 11:18 AM
PawsomeGirl's Avatar
PawsomeGirl
Trading Teddy
 
Join Date: Jan 2009
Posts: 45,141
PawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond reputePawsomeGirl has a reputation beyond repute
 PawsomeGirl is offline Status: Offline
Default

Alice's bday is in decemberrrr
  #7  
Old 06-29-2015, 02:25 PM
AliceDecember7's Avatar
AliceDecember7
Trading Teddy
BABV Name: alice
 
Join Date: Dec 2009
Posts: 25,335
AliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond reputeAliceDecember7 has a reputation beyond repute
 AliceDecember7 is offline Status: Offline
Default

View Post Originally Posted by PawsomeGirl
Alice's bday is in decemberrrr
idk if alicedecember7 was a giveaway or not yikes
  #8  
Old 06-29-2015, 04:53 PM
VanessaMay18's Avatar
VanessaMay18
Trading Teddy
BABV Name: VanessaMay18 is alive again!
 
Join Date: Oct 2008
Posts: 14,115
VanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud of
 VanessaMay18 is offline Status: Offline
Default

Would anyone care to explain what curry day is? Is it a rally day or just a day when you guys eat curry? XD
  #9  
Old 06-29-2015, 07:54 PM
CambriaSpeedRacer's Avatar
CambriaSpeedRacer
Polar Bear
BABV Name: CambriaSpeedRacer on Worlize!
 
Join Date: Jul 2014
Posts: 7,744
CambriaSpeedRacer is a name known to allCambriaSpeedRacer is a name known to allCambriaSpeedRacer is a name known to allCambriaSpeedRacer is a name known to allCambriaSpeedRacer is a name known to allCambriaSpeedRacer is a name known to all
 CambriaSpeedRacer is offline Status: Offline
Default

Apples are rubbish
  #10  
Old 06-29-2015, 07:56 PM
VanessaMay18's Avatar
VanessaMay18
Trading Teddy
BABV Name: VanessaMay18 is alive again!
 
Join Date: Oct 2008
Posts: 14,115
VanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud ofVanessaMay18 has much to be proud of
 VanessaMay18 is offline Status: Offline
Default

Phineas: It starts with a simple cold is a real roller coaster
Beach party scene, so I ran trucks.
We had a miracle of faith and belief is one of the biggest songs,
And strange happened between the two countries that Candice was sent to Mars.
Phineas and Danny Jacob made car, Bigfoot hunting and later,
There is a bar father.
Candice: If you break my brothers, that's just a dream!
Phineas: But it was just a dream? Here is where Perry?
Candace: Well, I think it's a dream dreamed Perry.
Buford: blowing my mind ...

Phineas and eat: This is a 104-day summer vacation
It was a lot of fun, singing and more
So now is the time for fun
Since this is a large summer
Thank you together for life?
Starring: Thank you to live with it?
Thank you together for life?

Resident Girls: Thank you all to live together, but ...
Thank you all live together?


Buford: I want to thank you live together?

Doofenshmirtz: I have a few feet, and I play a little platypus!
Yes, I think there are so successful.
Many systems and Inatori!
But I do not know ...
Doofenshmirtz and over and over again they throw
Several times
And more!
Doofenshmirtz: AW ... but it was fun, too!

Phineas: What thing against terrorism today Zombies Medicine
ColdFusion is an experience, but in the production.
We met a lot of sea monsters nose Klimpaloon
Phineas, Ferb and Candace: But we are also concerned about the son of the giant floating head.
Phineas and Isabella: you play, field hockey to Z-9 Football X-7
We went "around the world, and also at the end of the song.
Phineas and Baljeet: We met with colleagues from another country.
Phineas, Isabella and kissed me, but I feel that ...
Isabella: Wait, what?
Phineas: Wait 10 Years Old!

All summer hundred 80 days
It was a lot of fun, singing and more
Therefore, we believe that half
And hot girl
So, thank you for living together?

Starring: Thank you to live with it?
Thank you together for life?
Thank you together for life?
Resident Girls: Thank you all to live together, but ...
Thank you all live together, but ...
Thank you all live together, but ...

Phineas: I'm through!
Thank you for coming alooooooonnnng!
Make room!


Danny James reached singers want to thank all the only co Comin ...
I just want to thank all the co-operation only comin ...

#ihaveafewfeetandiplayalittleplatypus

View Post Originally Posted by CambriaSpeedRacer
Apples are rubbish
I'm eating one now.
Closed Thread
Membear Info
 

ADVERTISEMENT


Tags
abbygail, alicelovesyou, ciara4lyfe, donotdropthebear, frogs rule!!!, go team baymax! :), internet safety, jalex keeps me alive, komaeda the unicorn, noonewashere, perry-is-ugly, princessashtonwashere, steven-is-bae, whenwillweusethisinlife, you've got that wrong!

Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

BB code is On
Smilies are On
[IMG] code is On
HTML code is Off



All times are GMT -4. The time now is 06:56 AM.



Powered by vBulletin® Version 3.8.7
Copyright ©2000 - 2018, vBulletin Solutions, Inc.
Bearville Insider © 2008-2011 Kopi Enterprises, LLC
Bearvilleinsider.com is not an official site of, sponsored by, nor affiliated with Build A Bear Workshop®, buildabearville.com™, or Build-A-Bear Workshop, Inc.
no new posts